Protein coding transcript 184857

• Transcript: Ll_transcript_1162
• CDS coordinates: 1868-2698 (+)
• Peptide sequence: MKIQCNVCEAAEAKVLCCADEAALCWECDEKVHAANKLASKHQRVPLSISASPMPNCDICQDTVGYFFCLEDRALLCRNCDVVIHTVNAHVSAHQRFLLTGVRVGLEATKPGSSTSLAKSHSEEKISNTKSSSISGNVSPMPQPFNHNEVLPIQVGRVGEFPPPKVSYGVDSTVGNVSHWPVDEFPWLSEFGQNYNCMSGSSKVDSGKLWDSDSSLVRTCEAEMDNDDFLGSVPDSCWTVPQIPSPPTASGLYWPKDSQYTSDAMFVPDICFSHMQ*
• ORF Type: complete

Annotations of Ll_transcript_1162

• Blastp: B-box zinc finger protein 22 from Arabidopsis with 52.61% of identity
• Blastx: B-box zinc finger protein 22 from Arabidopsis with 50% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G78600)
• CantataDB: Link to cantataDB annotations (CNT0000728)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449227.1)
• Pfam: B-box zinc finger (PF00643.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;