Protein coding transcript 184870

• Transcript: Ll_transcript_1735
• CDS coordinates: 1226-1567 (+)
• Peptide sequence: MHEKMKIQAKSDDIWRYRQVTLIILLYAGSGSIFETLKVGKPLIVVVNEDLMDNHQSELAEELAERKHLYYASPQTLHQTISDMNLESLIRYSPGDATPVAKHIDRFLGFPDD*
• ORF Type: complete

Annotations of Ll_transcript_1735

• Blastp: UDP-N-acetylglucosamine transferase subunit ALG13 homolog from Rattus with 38.1% of identity
• Blastx: UDP-N-acetylglucosamine transferase subunit ALG13 homolog from Rattus with 35% of identity
• Eggnog: glycosyltransferase(COG5017)
• Kegg: Link to kegg annotations (300284)
• CantataDB: Link to cantataDB annotations (CNT0000591)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445863.1)
• Pfam: Glycosyltransferase family 28 C-terminal domain (PF04101.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;