Protein coding transcript 184913

• Transcript: Ll_transcript_1777
• CDS coordinates: 158-1372 (+)
• Peptide sequence: MQWLAVRNGVVLLPRLRSFALFLSSPTPSTSIPFIPSRMFKGQPEQVLCFTDRKVVRGSSKAAKKHKAQNIVLDDKNLSHILWWKERMEIFRKPSTIQLLRRLEYSNLLGLDTNLKNGSLKEGTLNWEILQFKSRFPREVLLCRVGDFYEAIGIDACILVEYAGLNPFGGLRSDSIPRAGCPVVNLRQTLDDLTRNGFSVCIVEEVQGPAQARGRKDRFISGHAHPGNPYVYGLVGVDHDLDFPEPMPVVGISRSARGYCIILVLETMKTYSSEDSLTEEAVVTKLRTCHYHHLFIHTSLRKNSSGTFRWSEYGEGGLLWGECSSKYFEWFDGNPVSEILFKVKELYGLDDEVIFRNTTVPLENRPRPLTLGTATQIGVIPTEGIPSLLKVILPSNCTGLPLLR*
• ORF Type: complete

Annotations of Ll_transcript_1777

• Blastp: DNA mismatch repair protein MSH1, mitochondrial from Arabidopsis with 69.8% of identity
• Blastx: DNA mismatch repair protein MSH1, mitochondrial from Arabidopsis with 69.73% of identity
• Eggnog: that it carries out the mismatch recognition step. This protein has a weak ATPase activity (By similarity)(COG0249)
• Kegg: Link to kegg annotations (AT3G24320)
• CantataDB: Link to cantataDB annotations (CNT0002490)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428545.1)
• Pfam: MutS domain I (PF01624.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;