Protein coding transcript 184951

• Transcript: Ll_transcript_2782
• CDS coordinates: 178-696 (+)
• Peptide sequence: MGLVFTRLFSSLFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAIIYVVDSSDTDRLVIAKEEFHAILEEEELKGAVALIFANKQDLPGAIDDAAVTEALELHKIKNRQWAIFKTSAIKGEGLFEGLDW*
• ORF Type: complete

Annotations of Ll_transcript_2782

• Blastp: ADP-ribosylation factor 1 from Brassica with 92.44% of identity
• Blastx: ADP-ribosylation factor 1 from Brassica with 92.44% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (103842229)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442232.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;