Transcript | Ll_transcript_2770 |
---|---|
CDS coordinates | 178-528 (+) |
Peptide sequence | MGLVFTRLFSSLFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAIIYVVDSSDTDRLVIAKEEFHAILEVNCS* |
ORF Type | complete |
Blastp | ADP-ribosylation factor 1 from Brassica with 92.86% of identity |
---|---|
Blastx | ADP-ribosylation factor 1 from Brassica with 92.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (103842229) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442232.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer