Protein coding transcript 184955

• Transcript: Ll_transcript_2557
• CDS coordinates: 313-693 (+)
• Peptide sequence: MGRDNHVICAKRLGFISISLFFLITSSWTLQGFVTEEGSRKTPKQNGFQQIVHDDKVMVRARVGSRPPKCEKRCRSCGPCEAIQVPTNPQAQNGKININPSMVPTAAYERGDNVYYKPMSWKCKCGN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_2557

• Blastp: EPIDERMAL PATTERNING FACTOR-like protein 2 from Arabidopsis with 56.25% of identity
• Blastx: EPIDERMAL PATTERNING FACTOR-like protein 2 from Arabidopsis with 56.25% of identity
• Eggnog: epidermal patterning factor-like protein(ENOG410YZE3)
• Kegg: Link to kegg annotations (AT4G37810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420554.1)
• Pfam: Epidermal patterning factor proteins (PF17181.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;