Transcript | Ll_transcript_1561 |
---|---|
CDS coordinates | 433-750 (+) |
Peptide sequence | MEINASYDIELSRSTERMQHELWPLDPVDPKKAKFPCCLVWNPLPVVSWLAPFIGHVGLCREDGVVLDFSGSNFVNIDEFAFGAVARYVQLDRRQVLFLKFTIGI* |
ORF Type | complete |
Blastp | Protein REVERSION-TO-ETHYLENE SENSITIVITY1 from Arabidopsis with 60.78% of identity |
---|---|
Blastx | Protein REVERSION-TO-ETHYLENE SENSITIVITY1 from Arabidopsis with 60.78% of identity |
Eggnog | Transmembrane protein 222(ENOG4111G1S) |
Kegg | Link to kegg annotations (AT2G26070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437741.1) |
Pfam | Protein of unknown function (DUF778) (PF05608.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer