Transcript | Ll_transcript_1585 |
---|---|
CDS coordinates | 851-1630 (+) |
Peptide sequence | MQNSVPALTFLMAALLRYESVYLNRIDGVAKVLGVIATVGGATVITLYKGPTIYTPNLSLHEKQFLPVLGDAEEKNWNLGCICLFGHCLSWSGWIVMQAFVLKKYPASLTVTAFTCFFGVVQFMTIAAFFVKDSKAWLLNSTSEIYSILYSGVVISALAAAIQIWTISKGGPVFASIYLPLQTLIVALMAPFLLGEEFFLGGVIGAFLIISGLYLVVWGKSEETKFAKEVIVLIDPKNHPEEKCSSSSLIHPLIPTQKS* |
ORF Type | complete |
Blastp | Protein WALLS ARE THIN 1 from Arabidopsis with 62.23% of identity |
---|---|
Blastx | Protein WALLS ARE THIN 1 from Arabidopsis with 58.13% of identity |
Eggnog | Auxin-induced protein(ENOG410YAV4) |
Kegg | Link to kegg annotations (AT1G75500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421221.1) |
Pfam | EamA-like transporter family (PF00892.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer