Protein coding transcript 185009

• Transcript: Ll_transcript_1587
• CDS coordinates: 852-1355 (+)
• Peptide sequence: MQNSVPALTFLMAALLRYESVYLNRIDGVAKVLGVIATVGGATVITLYKGPTIYTPNLSLHEKQFLPVLGDAEEKNWNLGCICLFGHCLSWSGWIVMQAFVLKKYPASLTVTAFTCFFGVVQFMTIAAFFVKDSKAWLLNSTSEIYSILYSVCESNSSLYLHLSLAC*
• ORF Type: complete

Annotations of Ll_transcript_1587

• Blastp: Protein WALLS ARE THIN 1 from Arabidopsis with 61.15% of identity
• Blastx: Protein RTE1-HOMOLOG from Arabidopsis with 61.23% of identity
• Eggnog: Auxin-induced protein(ENOG410YAV4)
• Kegg: Link to kegg annotations (AT1G75500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421224.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;