Protein coding transcript 185011

• Transcript: Ll_transcript_1570
• CDS coordinates: 138-1229 (+)
• Peptide sequence: MVVPERAKLHIALTFLQFCHAGNHIFLRIALNTGISKFVLPVYRNITALVLLGPLAYFSEKKDRPSVTSYCVIQFFLLGLVGITLKEGFYLVGLENTSPTFASAMQNSVPALTFLMAALLRYESVYLNRIDGVAKVLGVIATVGGATVITLYKGPTIYTPNLSLHEKQFLPVLGDAEEKNWNLGCICLFGHCLSWSGWIVMQAFVLKKYPASLTVTAFTCFFGVVQFMTIAAFFVKDSKAWLLNSTSEIYSILYSGVVISALAAAIQIWTISKGGPVFASIYLPLQTLIVALMAPFLLGEEFFLGGVIGAFLIISGLYLVVWGKSEETKFAKEVIVLIDPKNHPEEKCSSSSLIHPLIPTQKS*
• ORF Type: complete

Annotations of Ll_transcript_1570

• Blastp: Protein WALLS ARE THIN 1 from Arabidopsis with 60.11% of identity
• Blastx: Protein WALLS ARE THIN 1 from Arabidopsis with 58.81% of identity
• Eggnog: Auxin-induced protein(ENOG410YAV4)
• Kegg: Link to kegg annotations (AT1G75500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421220.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;