Transcript | Ll_transcript_1579 |
---|---|
CDS coordinates | 138-1154 (+) |
Peptide sequence | MVVPERAKLHIALTFLQFCHAGNHIFLRIALNTGISKFVLPVYRNITALVLLGPLAYFSEKKDRPSVTSYCVIQFFLLGLVGITLKEGFYLVGLENTSPTFASAMQNSVPALTFLMAALLRYESVYLNRIDGVAKVLGVIATVGGATVITLYKGPTIYTPNLSLHEKQFLPVLGDAEEKNWNLGCICLFGHCLSWSGWIVMQAFVLKKYPASLTVTAFTCFFGVVQFMTIAAFFVKDSKAWLLNSTSEIYSILYSGVVISALAAAIQIWTISKGGPVFASIYLPLQTLIVALMAPFLLGEEFFLGGSVLVIQATSVSFCFLKFSHAKICYSLGCLNIH* |
ORF Type | complete |
Blastp | Protein WALLS ARE THIN 1 from Arabidopsis with 61.32% of identity |
---|---|
Blastx | Protein WALLS ARE THIN 1 from Arabidopsis with 61.32% of identity |
Eggnog | Auxin-induced protein(ENOG410YAV4) |
Kegg | Link to kegg annotations (AT1G75500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421220.1) |
Pfam | EamA-like transporter family (PF00892.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer