Protein coding transcript 185035

• Transcript: Ll_transcript_244
• CDS coordinates: 354-833 (+)
• Peptide sequence: MAEEAILGYLEHNDEIKDSGEFAGERNIDHSEIVNVIKSLYGFRYVDVEDIKRESWVLTDEGNIYAESGSPEVQLFLAVPEEGIVKDELLKKVGPSLFKIGCAQAAKNKWLDLGKQLITRKLQHVDDKVKHLLLQIQQGQGIGSDDIKALKARKLIVPQ*
• ORF Type: complete

Annotations of Ll_transcript_244

• Blastp: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 67.5% of identity
• Blastx: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 70.59% of identity
• Eggnog: phenylalanyL-tRNA synthetase, alpha subunit(COG0016)
• Kegg: Link to kegg annotations (AT4G39280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448494.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;