| Transcript | Ll_transcript_594 |
|---|---|
| CDS coordinates | 1-321 (+) |
| Peptide sequence | FEEKWLQLLPKVVDEEKRQLEEESQAQLDTLLAQATTYENMARDLSSELSEVDMHLKSLKEMVIQKFRFVKKSFISWSLSLRSIYSGKFSLYLFMSFISYPHDYEV* |
| ORF Type | 5prime_partial |
| Blastp | Transcription factor GTE1 from Arabidopsis with 47.06% of identity |
|---|---|
| Blastx | Transcription factor GTE1 from Arabidopsis with 50.85% of identity |
| Eggnog | bromodomain(COG5076) |
| Kegg | Link to kegg annotations (AT2G34900) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446961.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer