Transcript | Ll_transcript_609 |
---|---|
CDS coordinates | 326-1018 (+) |
Peptide sequence | MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALYGGGFDFLTAFVVLILFHSLLVMLLWSYFSAVFTDPGSVPPNWKPALDEERGDTDPLVASEFNNGVPSDPSSQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTASLLPQFLAFFGDGEIPGTPGSLATTFIAFGMESKHNSSCWCRL* |
ORF Type | complete |
Blastp | Probable protein S-acyltransferase 14 from Arabidopsis with 80.73% of identity |
---|---|
Blastx | Probable protein S-acyltransferase 14 from Arabidopsis with 80.73% of identity |
Eggnog | Zinc finger, DHHC-type containing(COG5273) |
Kegg | Link to kegg annotations (AT3G60800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433651.1) |
Pfam | DHHC palmitoyltransferase (PF01529.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer