Transcript | Ll_transcript_2313 |
---|---|
CDS coordinates | 164-796 (+) |
Peptide sequence | MAGVVSGDLSHHGSSEGDSYRSSKDKLEEGIGCWYMSRREIEENSPSRIDGIDLKKETYLRKSYCTFLQDLGMRLKVPQVTIATAIIFCHRFFLRQSHARNDRRTIATVCMFLAGKVEETPRPLKDVILVSYEIIHKKDPAAAQRIKQKGVYEQQKELILLAERIVLATLAFDLNVQHPYKPLVEAIKKFNVAKNALAQVAWNFVNDGYD* |
ORF Type | complete |
Blastp | Cyclin-T1-4 from Oryza sativa with 81.34% of identity |
---|---|
Blastx | Cyclin-T1-4 from Oryza sativa with 81.73% of identity |
Eggnog | Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin-dependent kinase cdk8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex(COG5333) |
Kegg | Link to kegg annotations (4352229) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422010.1) |
Pfam | Cyclin, N-terminal domain (PF00134.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer