Transcript | Ll_transcript_2318 |
---|---|
CDS coordinates | 131-535 (+) |
Peptide sequence | MAGVVSGDLSHHGSSEGDSYRSSKDKLEEGIGCWYMSRREIEENSPSRIDGIDLKKETYLRKSYCTFLQDLGMRLKVPQVTIATAIIFCHRFFLRQSHARNDRRVGCCALSNNIVPLLLSVCSLLGRLRRPLVP* |
ORF Type | complete |
Blastp | Cyclin-T1-3 from Oryza sativa with 72.9% of identity |
---|---|
Blastx | Cyclin-T1-4 from Oryza sativa with 70.75% of identity |
Eggnog | NA(ENOG410ZAZC) |
Kegg | Link to kegg annotations (4349827) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422010.1) |
Pfam | Cyclin, N-terminal domain (PF00134.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer