Protein coding transcript 185124

• Transcript: Ll_transcript_890
• CDS coordinates: 1-306 (+)
• Peptide sequence: KETIFNFIERILKSRRKRSRGVQPCAFYLQNNNCKFGSACKFDHPWGPVRHSASTSSLIDMPVTPYPVASLLSTLAPSLTSSALRPESLSGSKLESFTTRI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_890

• Blastp: Zinc finger CCCH domain-containing protein 6 from Oryza sativa with 52.86% of identity
• Blastx: Zinc finger CCCH domain-containing protein 32 from Arabidopsis with 66.67% of identity
• Eggnog: zinc finger, CCCH(ENOG410Y25U)
• Kegg: Link to kegg annotations (4326236)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421554.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;