Transcript | Ll_transcript_893 |
---|---|
CDS coordinates | 245-1225 (+) |
Peptide sequence | MDLYGRNPIRNGSNPVNQTEWHSSGTDTGLEESMWQLTLSSSESYPERTGAPNCVYYMRTGFCGYGGGCRYNHPRDRAAVAAAVRATGEYPERVGEPPCQYYLKTGTCKFGASCKFHHPKHGGGSLSQAPLNIYGYPLRPGEKECSYYLKMGQCKFGITCKFHHPQPAGTSLPASAPQFYQQVQSPTVPLPDQYGGASTSLRVAKPPILPGSYVQGAYGPVLLSPGVVPFPGWNPYSAPVSPALSPGAQPAVGATSLYGVTQLNSSTSAFARPYTPLPSSSGPSGSNQNEQVFPERPGEPECQYFLRTGDCKFGLACRFHHPRDQVV |
ORF Type | 3prime_partial |
Blastp | Zinc finger CCCH domain-containing protein 32 from Arabidopsis with 71.87% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 32 from Arabidopsis with 71.25% of identity |
Eggnog | zinc finger(COG5063) |
Kegg | Link to kegg annotations (AT2G47850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421554.1) |
Pfam | Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer