Protein coding transcript 185138

• Transcript: Ll_transcript_2342
• CDS coordinates: 166-975 (+)
• Peptide sequence: MSSLFRFCHSSVKSIPKKEKKIESVDYMENGSEEKEKNMGLKLKETFFISHGSPTLAIDESIPAWKFLNSWKEVFPQRPSSILVISGHWDTNFPTVNVVDQNETIHDFYGFPRAMYKLKYPAPGAPNLAKRVKELLLASGLNHIDEEKKRGLDHGAWVPLMLMYPEADIPVCQLSLSSKRGATYHYNMGKALAPLKDEGVLIIGSGSATHNLSTIAPRTTPPAPWALAFMSWLKDSLLHGRYISISFLFPYLYRNRRHFAIVVVSVLVM*
• ORF Type: complete

Annotations of Ll_transcript_2342

• Blastp: Extradiol ring-cleavage dioxygenase from Arabidopsis with 66.03% of identity
• Blastx: Extradiol ring-cleavage dioxygenase from Arabidopsis with 66.03% of identity
• Eggnog: extradiol ring-cleavage dioxygenase class IIi protein subunit b(COG3384)
• Kegg: Link to kegg annotations (AT4G15093)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419399.1)
• Pfam: Catalytic LigB subunit of aromatic ring-opening dioxygenase (PF02900.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;