Transcript | Ll_transcript_392848 |
---|---|
CDS coordinates | 950-1900 (+) |
Peptide sequence | MHSEHSSVVQCPLVGTFYYGTPLDLNYSNIFTIKGNGFSASDLPPADQKQPAWKPYLFKGKQRMLFTIHETVHAALYDRDDIPDIISVSGQINCRADLEGLPDVSFPLAGLKTANLEVSSYHPCAQVSDQGLDKQGVMFSPPLGNFVLMRYQATCALGPPVKGFYQLSMVSEDKGAFLFKLRLMEGYKAPLTMEFCTVALPFPRRRIISLDGTPSLGTVSTSDHSLEWKIVTSGRGLSGKSIEVTFPGTINFAPWQIQRAPSSRSSFGIIADDDSDNEAENSSNMVNEEHLMEKMNKDLPPVDLEEPFCWQAYNYAK |
ORF Type | 3prime_partial |
Blastp | AP-5 complex subunit mu from Arabidopsis with 68.56% of identity |
---|---|
Blastx | AP-5 complex subunit mu from Arabidopsis with 68% of identity |
Eggnog | Adaptor-related protein complex(ENOG410XPFS) |
Kegg | Link to kegg annotations (AT2G20790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463021.1) |
Pfam | Adaptor complexes medium subunit family (PF00928.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer