Protein coding transcript 18516

• Transcript: Ll_transcript_392849
• CDS coordinates: 962-1912 (+)
• Peptide sequence: MHSEHSSVVQCPLVGTFYYGTPLDLNYSNIFTIKGNGFSASDLPPADQKQPAWKPYLFKGKQRMLFTIHETVHAALYDRDDIPDIISVSGQINCRADLEGLPDVSFPLAGLKTANLEVSSYHPCAQVSDQGLDKQGVMFSPPLGNFVLMRYQATCALGPPVKGFYQLSMVSEDKGAFLFKLRLMEGYKAPLTMEFCTVALPFPRRRIISLDGTPSLGTVSTSDHSLEWKIVTSGRGLSGKSIEVTFPGTINFAPWQIQRAPSSRSSFGIIADDDSDNEAENSSNMVNEEHLMEKMNKDLPPVDLEEPFCWQAYNYAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_392849

• Blastp: AP-5 complex subunit mu from Arabidopsis with 68.56% of identity
• Blastx: AP-5 complex subunit mu from Arabidopsis with 68% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPFS)
• Kegg: Link to kegg annotations (AT2G20790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463021.1)
• Pfam: Adaptor complexes medium subunit family (PF00928.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;