Protein coding transcript 1852

• Transcript: Ll_transcript_491537
• CDS coordinates: 2-538 (+)
• Peptide sequence: LIHGVFCFDLPIVQRMGRLPFDFSRFSDGHMSPEKGWGFNAFVRAYFAYLDHKSVFVCTKAKKLRRNGNENRTEETLMEELQNSEKLQGLIDMLIQIKPWNEDMKVVLILEAMDCIMDEVIELYDTFCTEIDRLLVKIYDVGGKVEASIGLSIIEKAEFQGDKVSLFFFFFWDIGVLNA
• ORF Type: internal

Annotations of Ll_transcript_491537

• Blastp: Putative clathrin assembly protein At1g25240 from Arabidopsis with 46.37% of identity
• Blastx: Putative clathrin assembly protein At1g25240 from Arabidopsis with 46.37% of identity
• Eggnog: Clathrin assembly protein(ENOG410XQ90)
• Kegg: Link to kegg annotations (AT1G25240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420488.1)
• Pfam: ANTH domain (PF07651.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;