Transcript | Ll_transcript_831 |
---|---|
CDS coordinates | 1-1203 (+) |
Peptide sequence | LSFPYTMPFLSLLALIDNLLKISMLILCPFLVLSSVVNEPLERISLDLGFNGNTLAEGLVVSICLGGALIGCLLSGWIADGVGRRRAFQLSALPMIIGASMSAATNNLFGMLVGRLFVGTGLGLGPPVASLYVAEVSPAFVRGTYGAFIQIATCLGLMGALLIGIPVHKIPGWWRVCFWLSTIPAAILALAMVFCAESPHWLYKQGRTAEAEAEFERLLGVPEAKFAMSELSKADRGDDNDTVKLSELLRGRHFKGIYFFLIYLWDIYECICQCYLVTGFCRLPKVMFYSRVRFAVVFIGSSLFALQQLSGINAVFYFSSTVFKSAGVPSDLANVCIGIVNLSGIDTFWLQVIDLKLCYSICLNGFFVLSPGSIISMILMDKLGRKVLLFWSFFGMVNYA* |
ORF Type | 5prime_partial |
Blastp | Probable plastidic glucose transporter 2 from Arabidopsis with 60.33% of identity |
---|---|
Blastx | Probable plastidic glucose transporter 2 from Arabidopsis with 60.33% of identity |
Eggnog | Transporter(ENOG410XNQK) |
Kegg | Link to kegg annotations (AT1G67300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458060.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer