Protein coding transcript 185269

• Transcript: Ll_transcript_832
• CDS coordinates: 1-624 (+)
• Peptide sequence: LSFPYTMPFLSLLALIDNLLKISMLILCPFLVLSSVVNEPLERISLDLGFNGNTLAEGLVVSICLGGALIGCLLSGWIADGVGRRRAFQLSALPMIIGASMSAATNNLFGMLVGRLFVGTGLGLGPPVASLYVAEVSPAFVRGTYGAFIQIATCLGLMGALLIGIPVHKIPGWWRVCFWLSTIPAAILALAMVFCAESPHWLYKVNS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_832

• Blastp: Probable plastidic glucose transporter 2 from Arabidopsis with 76.33% of identity
• Blastx: Probable plastidic glucose transporter 2 from Arabidopsis with 76.33% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G67300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458059.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;