Protein coding transcript 185270

• Transcript: Ll_transcript_833
• CDS coordinates: 2785-3474 (+)
• Peptide sequence: MSELSKADRGDDNDTVKLSELLRGRHFKVVFIGSSLFALQQLSGINAVFYFSSTVFKSAGVPSDLANVCIGIVNLSGSIISMILMDKLGRKVLLFWSFFGMAIAMVVQATGASLLVSGLGTMYFSVGGILLFVLTFALGAGPVPGLLLPEIFPSRIRAKAMAVCMSVHWVINFFVGLLFLRLLEKLGAQLLYSIFASFCMIAVVFVKRNVVETKGKSLQEIEIALLPQD*
• ORF Type: complete

Annotations of Ll_transcript_833

• Blastp: Probable plastidic glucose transporter 3 from Arabidopsis with 69.91% of identity
• Blastx: Probable plastidic glucose transporter 2 from Arabidopsis with 72.05% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G79820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458059.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;