Protein coding transcript 185273

• Transcript: Ll_transcript_837
• CDS coordinates: 1098-1454 (+)
• Peptide sequence: MDGWLIGNLCIFSAATNNLFGMLVGRLFVGTGLGLGPPVASLYVAEVSPAFVRGTYGAFIQIATCLGLMGALLIGIPVHKIPGWWRVCFWLSTIPAAILALAMVFCAESPHWLYKVNS*
• ORF Type: complete

Annotations of Ll_transcript_837

• Blastp: Probable plastidic glucose transporter 2 from Arabidopsis with 77.67% of identity
• Blastx: Probable plastidic glucose transporter 2 from Arabidopsis with 72.99% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G67300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458057.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;