Transcript | Ll_transcript_433 |
---|---|
CDS coordinates | 116-574 (+) |
Peptide sequence | MSSSCPTNPSSSTTRPHTYNRKQKSLGLLCTNFLNLYNRDEIHLIGLDDAAARLGVERRRIYDIVNVLESIGVLARKAKNQYTWKGYAAIPGALHELKEEALRERLEGSQGVNAKVWDDEDDDETLSNSGSQNDKSIPNSDAPKSQKNGNNI* |
ORF Type | complete |
Blastp | E2F transcription factor-like E2FE from Arabidopsis with 61.42% of identity |
---|---|
Blastx | E2F transcription factor-like E2FE from Arabidopsis with 80.26% of identity |
Eggnog | E2F transcription factor(ENOG4111IGY) |
Kegg | Link to kegg annotations (AT3G48160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464340.1) |
Pfam | E2F/DP family winged-helix DNA-binding domain (PF02319.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer