Protein coding transcript 185344

• Transcript: Ll_transcript_1508
• CDS coordinates: 1735-2838 (+)
• Peptide sequence: MQEQRVKSAAVVTDLKPPPAENVMIERVPTKSGSVRQMKSPITSTSYTVASLQSATNSFSQEFIVGEGSLGRVYKADFPNGKIMAIKKIDNSALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYIENGNLHDMLHFAEDSSKDLSWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRDRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRPSEESGFGHKTPDHEAIDMSF*
• ORF Type: complete

Annotations of Ll_transcript_1508

• Blastp: Protein STRUBBELIG-RECEPTOR FAMILY 8 from Arabidopsis with 82.02% of identity
• Blastx: Protein STRUBBELIG-RECEPTOR FAMILY 8 from Arabidopsis with 69.54% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G22130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439840.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;