Protein coding transcript 185371

• Transcript: Ll_transcript_1676
• CDS coordinates: 104-724 (+)
• Peptide sequence: MMMLSRSVHAKVSNTSIMMVATRFFSTVRSTVEVGDTVVFGAGKGDLCFGAPNKLGHWVRAPTTVHGVSVVRNGSTLAMSGKENKNKNDVGSSFESAASGGVGGNKEENKVVSYWGVQPPKVTKPDGTEWNWNCFRPWETYKADLSIDLNKHHAPVTFLDKMAYWTVKVLRYPTDIFFQVGFHVNILVSLVFWFSFCFAIKKSNHT*
• ORF Type: complete

Annotations of Ll_transcript_1676

• Blastp: Ubiquinol oxidase 1, mitochondrial from Nicotiana with 50.83% of identity
• Blastx: Ubiquinol oxidase 1a, mitochondrial from Arabidopsis with 95.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421475.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;