Transcript | Ll_transcript_1688 |
---|---|
CDS coordinates | 104-724 (+) |
Peptide sequence | MMMLSRSVHAKVSNTSIMMVATRFFSTVRSTVEVGDTVVFGAGKGDLCFGAPNKLGHWVRAPTTVHGVSVVRNGSTLAMSGKENKNKNDVGSSFESAASGGVGGNKEENKVVSYWGVQPPKVTKPDGTEWNWNCFRPWETYKADLSIDLNKHHAPVTFLDKMAYWTVKVLRYPTDIFFQVGFHVNILVSLVFWFSFCFAIKKSNHT* |
ORF Type | complete |
Blastp | Ubiquinol oxidase 1, mitochondrial from Nicotiana with 50.83% of identity |
---|---|
Blastx | Ubiquinol oxidase 1, mitochondrial from Soja with 95.08% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421475.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer