| Transcript | Ll_transcript_248 |
|---|---|
| CDS coordinates | 2-550 (+) |
| Peptide sequence | ANPLPKKITFFYKPLKSPQELANSSEEADSRNQKLVLTLYEALNSSDSDTVVKTVASDLEWWFHGPPSHQFLMRLLTGETVNDFRFVPQSLVSFGNTVIVEGCDGNRKICWVHAWTVSDGIITQVREYFNTSLTVTRLGDSDSDSDSGSEIVGSDSVPFACVWESSVSNRVGKSVPGLVLAI* |
| ORF Type | 5prime_partial |
| Blastp | Wound-induced protein 1 from Solanum with 56.64% of identity |
|---|---|
| Blastx | Senescence associated gene 20 from Arabidopsis with 56.52% of identity |
| Eggnog | wound-induced protein(ENOG41125QD) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415250.1) |
| Pfam | Wound-induced protein WI12 (PF07107.10) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer