Protein coding transcript 185392

• Transcript: Ll_transcript_268
• CDS coordinates: 217-591 (+)
• Peptide sequence: MSILGKLRCVTVDVTGTLMAYKGELGDYYCMAAKSVGLPCPDYKRMHEGFKFAYKEMATKYPCFGFDAKMPNIVWWKTCVRDSFVRAGYDYNEETFEKIFRRIYSTFGSSAPYTIFPDSQPFLRW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_268

• Blastp: Haloacid dehalogenase-like hydrolase domain-containing protein 3 from Danio with 28.81% of identity
• Blastx: Haloacid dehalogenase-like hydrolase domain-containing protein 3 from Danio with 28.81% of identity
• Eggnog: Hydrolase(COG1011)
• Kegg: Link to kegg annotations (553464)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426458.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;