Protein coding transcript 185395

• Transcript: Ll_transcript_254
• CDS coordinates: 1348-1866 (+)
• Peptide sequence: MFFVQAGYDYNEETFEKIFRRIYSTFGSSAPYTIFPDSQPFLRWLRGKGLKVGIVSNAEYRYKDVILPALGINEGSEWDFGVFSGFEGVEKPNPKFFEIALERAGNLKPEEVLHIGDSMRKDYEPAKSIGMQAILLDRFKTPDAVEWRKSGAVVLPDLVAAQEWLSSENSTL*
• ORF Type: complete

Annotations of Ll_transcript_254

• Blastp: Haloacid dehalogenase-like hydrolase domain-containing protein 3 from Bos with 34.33% of identity
• Blastx: Haloacid dehalogenase-like hydrolase domain-containing protein 3 from Bos with 34.33% of identity
• Eggnog: Hydrolase(COG1011)
• Kegg: Link to kegg annotations (510680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426458.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF00702.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;