Transcript | Ll_transcript_257 |
---|---|
CDS coordinates | 1613-2131 (+) |
Peptide sequence | MFFVQAGYDYNEETFEKIFRRIYSTFGSSAPYTIFPDSQPFLRWLRGKGLKVGIVSNAEYRYKDVILPALGINEGSEWDFGVFSGFEGVEKPNPKFFEIALERAGNLKPEEVLHIGDSMRKDYEPAKSIGMQAILLDRFKTPDAVEWRKSGAVVLPDLVAAQEWLSSENSTL* |
ORF Type | complete |
Blastp | Haloacid dehalogenase-like hydrolase domain-containing protein 3 from Bos with 34.33% of identity |
---|---|
Blastx | Endo-1,3;1,4-beta-D-glucanase from Zea with 49.25% of identity |
Eggnog | Hydrolase(COG1011) |
Kegg | Link to kegg annotations (510680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426458.1) |
Pfam | haloacid dehalogenase-like hydrolase (PF00702.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer