Protein coding transcript 185399

• Transcript: Ll_transcript_262
• CDS coordinates: 63-587 (+)
• Peptide sequence: MSSPQCFENPPNLNSVIHLAGTTQQFGGLKSYVTGPSDSKSALILISDVFGYESPNLRKLADKVAAAGFLVVVPDLLYGEYVDLDNPQFDRDSWRKAHAPEKASEDTKPLIAALKSKGVTAIGAAGFCWGGVVVVKLALSSSSDIQAAVILHPGPVTDDELNGKFVLFGFVVRH*
• ORF Type: complete

Annotations of Ll_transcript_262

• Blastp: Endo-1,3;1,4-beta-D-glucanase from Zea with 45.45% of identity
• Blastx: Endo-1,3;1,4-beta-D-glucanase from Zea with 44.85% of identity
• Eggnog: dienelactone hydrolase(COG0412)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439773.1)
• Pfam: Dienelactone hydrolase family (PF01738.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;