Protein coding transcript 1855

• Transcript: Ll_transcript_491632
• CDS coordinates: 1195-1590 (+)
• Peptide sequence: MGSRNFSPDDRPPVRFMDTDELAYVAMRAREVHDFWHTLFGLPTNLIGESALKVIEFEQMYLPMCLLSVIGGTARFSEKQRKLFYQHYFPWAIRAGVQCTDLMCVYYERHFHEDLEDVRRKLGIVPVPPVP*
• ORF Type: complete

Annotations of Ll_transcript_491632

• Blastp: Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial from Arabidopsis with 83.97% of identity
• Blastx: Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial from Arabidopsis with 85.9% of identity
• Eggnog: Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides (By similarity)(COG5031)
• Kegg: Link to kegg annotations (AT2G03690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434267.1)
• Pfam: Coenzyme Q (ubiquinone) biosynthesis protein Coq4 (PF05019.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;