Protein coding transcript 185590

• Transcript: Ll_transcript_1896
• CDS coordinates: 141-1205 (+)
• Peptide sequence: MTTFIRRIGLSYIFLTFFLSLGIGFFECVASFGINYGQVANNLPPPEKVLELFSYFKITKTRIYDTNPEILNAFANSNIEVIVTIENGMLSQLSDPQQALQWVSDHIKPYLPDTKITGIQVGNEIFSDGDISLIQSLVPALVNIHNALAQLGIGSNIQVSTPCSLSVLEQSYPPSAGSFKSEISDIMHQFLDFLSSTKAPFWINAYPYFAYKDAPNEISLDYVLFNPSVGMVDPNTKLHYDNMLYAQVDAVIFAIANMGFNGIEVRVSETGWPSKGDSDEAGATMQNAATYNKNLLRRQIANEGLSAFATTSASSTSISLTSSATNTKAAPKGYQTLFYWILLYVLTSTLRGSL*
• ORF Type: complete

Annotations of Ll_transcript_1896

• Blastp: Glucan endo-1,3-beta-glucosidase 14 from Arabidopsis with 50.72% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 14 from Arabidopsis with 51.88% of identity
• Eggnog: glucan endo-1-3-beta-glucosidase(ENOG410YA4N)
• Kegg: Link to kegg annotations (AT2G27500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445850.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;