Protein coding transcript 185652

• Transcript: Ll_transcript_1132
• CDS coordinates: 166-1002 (+)
• Peptide sequence: MATTATSAAAMSYFFSTRLTNPASNSGKFHALFKFNFGTKKAPPKKKEVKVKPSSDRLVWFPGAQSPEWLDGSLVGDRGFDPFGFAKPAEYLQYDLDSLDQNLAKNLAGEIIGTRVETTEVKPTPFQPYTEVFGLQRFRECELIHGRWAMLGALGALSVEAFTGVAWQDAGKVELVEGSSYFGLPLPFSITTLIWIEVLVIGYIEFQRNAELDPEKRLYPGGKFFDPLGLANDPEEKARLQLAEIKHSRLAMVVFLIFAIQAAVTGKGPISFIATFNK*
• ORF Type: complete

Annotations of Ll_transcript_1132

• Blastp: Chlorophyll a-b binding protein CP29.3, chloroplastic from Arabidopsis with 73.13% of identity
• Blastx: Chlorophyll a-b binding protein CP29.3, chloroplastic from Arabidopsis with 73.21% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410YYUX)
• Kegg: Link to kegg annotations (AT2G40100)
• CantataDB: Link to cantataDB annotations (CNT0000198)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439395.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;