Transcript | Ll_transcript_2505 |
---|---|
CDS coordinates | 121-669 (+) |
Peptide sequence | MILVGPSLGSAVAIDFAINYPEAVEKLVLIDASVYAEGTGNLATLPKAVAYAGVSVLKSIPLRLYANYLTFNNISFSISLDWTNIGRLHCLLPWWEDATVDFMTSGGYNVASQIKKVRQKTLIIWGENDRIISNKLAVQLHCDLSDAIIHQIPDCGHLPHVERPNSVVKFIAEFVKRDQGSK* |
ORF Type | complete |
Blastp | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase from Comamonas with 26.98% of identity |
---|---|
Blastx | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase from Comamonas with 27.69% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001074) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445900.1) |
Pfam | Alpha/beta hydrolase family (PF12697.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer