Protein coding transcript 185705

• Transcript: Ll_transcript_1645
• CDS coordinates: 903-1532 (+)
• Peptide sequence: MKGIAIDAPFDVFEENAQFRRAPPMVRVEKMFESIQSKLPGAPQFLLCLLPDRKNCEIYGPWKKKNLADYGIVNQCMCPTRVNDQFLTNVMLKINAKLGGLNSLLCVEHSPSLPIVSKAPTLILGMDVSHGSPGQSDIPSIAAVVSSRQWPLISKYRACVRTQSAKAEMIDNLFKKVSEKEDEGIMRELLLDFYVTSGKRKPDNIIIFR*
• ORF Type: complete

Annotations of Ll_transcript_1645

• Blastp: Protein argonaute 4 from Arabidopsis with 71.77% of identity
• Blastx: Protein argonaute 4 from Arabidopsis with 70.08% of identity
• Eggnog: eukaryotic translation initiation factor 2c(ENOG410XP07)
• Kegg: Link to kegg annotations (AT2G27040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440717.1)
• Pfam: Piwi domain (PF02171.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;