Protein coding transcript 185794

• Transcript: Ll_transcript_2524
• CDS coordinates: 1040-1378 (+)
• Peptide sequence: MMNEAREKRAKLKTAPPTIPMEIRVEKALDAIYVCCFEKNLIEEEDERLLVTMLSAVFPSVQQQEMERMVKEKGVKIAAGVRDYVAEAKPLSKEAVELQMKDLQFLKQNSET*
• ORF Type: complete

Annotations of Ll_transcript_2524

• Blastp: Photosystem I assembly factor PSA3, chloroplastic from Arabidopsis with 57.27% of identity
• Blastx: Photosystem I assembly factor PSA3, chloroplastic from Arabidopsis with 64.33% of identity
• Eggnog: calcium homeostasis regulator CHoR1(ENOG4111QT7)
• Kegg: Link to kegg annotations (AT3G55250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452890.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;