Protein coding transcript 185802

• Transcript: Ll_transcript_2538
• CDS coordinates: 443-907 (+)
• Peptide sequence: MGFCGNGISSMGSEEELKVLMDQRKRKRMISNRESARRSRMKKVKHFHDLSAKMAHLTNQNQQLLTTLNHTTQRYCILEAQNSVLRAQLGELNHRLHSLNHIIDFFNASNGVFEAMDFASRSFIDPAFDNFFNSFNVSYMNQPIMASAEAMLQY*
• ORF Type: complete

Annotations of Ll_transcript_2538

• Blastp: bZIP transcription factor 11 from Arabidopsis with 55.15% of identity
• Blastx: bZIP transcription factor 44 from Arabidopsis with 50% of identity
• Eggnog: ocs element-binding factor 1(ENOG410YNBU)
• Kegg: Link to kegg annotations (AT4G34590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438174.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;