Transcript | Ll_transcript_2539 |
---|---|
CDS coordinates | 214-621 (+) |
Peptide sequence | MADSGKVRLVRCPKCENILPELPHYSLYQCGACSAVLRAKDNGYLSGSLSEKSDDRKFGDSANSERSMEKGLADSIGDTSDVDAKFKSNNERDVKNGNNGHERFPIQPRDKETNENGNNGHERFPIQPRDKETNEN |
ORF Type | 3prime_partial |
Blastp | Protein ENHANCED DISEASE RESISTANCE 4 from Arabidopsis with 62.86% of identity |
---|---|
Blastx | Protein ENHANCED DISEASE RESISTANCE 4 from Arabidopsis with 62.86% of identity |
Eggnog | Protein of unknown function (DUF3133)(ENOG410YZZS) |
Kegg | Link to kegg annotations (AT5G05190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424022.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer