Protein coding transcript 185807

• Transcript: Ll_transcript_2383
• CDS coordinates: 2-475 (+)
• Peptide sequence: LVPIVGGVVLASVTEASFNWVGFWSAMASNFTNQFRNVLSKKVMVKKEDSIDNITLFSIITIMSFLLSAPVTIFAEGVKFTPSYLQAAGLNVNQVYIRSLLAALCFHAYQQVTSLLCIIFSLEFKNGVASSSSLFCFVSIRLKHRRYYYVKTKKHYL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_2383

• Blastp: Triose phosphate/phosphate translocator, non-green plastid, chloroplastic from Brassica with 75% of identity
• Blastx: Triose phosphate/phosphate translocator, non-green plastid, chloroplastic from Brassica with 75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457000.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;