Transcript | Ll_transcript_2383 |
---|---|
CDS coordinates | 2-475 (+) |
Peptide sequence | LVPIVGGVVLASVTEASFNWVGFWSAMASNFTNQFRNVLSKKVMVKKEDSIDNITLFSIITIMSFLLSAPVTIFAEGVKFTPSYLQAAGLNVNQVYIRSLLAALCFHAYQQVTSLLCIIFSLEFKNGVASSSSLFCFVSIRLKHRRYYYVKTKKHYL* |
ORF Type | 5prime_partial |
Blastp | Triose phosphate/phosphate translocator, non-green plastid, chloroplastic from Brassica with 75% of identity |
---|---|
Blastx | Triose phosphate/phosphate translocator, non-green plastid, chloroplastic from Brassica with 75% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457000.1) |
Pfam | Triose-phosphate Transporter family (PF03151.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer