| Transcript | Ll_transcript_1591 |
|---|---|
| CDS coordinates | 231-587 (+) |
| Peptide sequence | MVLLEKLWDDVVAGPHPERGLGKLRKLTTDIKDEGEGSKYERTVSMPTTPTTPVTPVTPRTPVSARKADNVWRSVFNPGSNSATKYMGAHQMFDKPLPNTPTVYDWLYSGESRSKHHR* |
| ORF Type | complete |
| Blastp | Dormancy-associated protein 1 from Pisum with 73.68% of identity |
|---|---|
| Blastx | Dormancy-associated protein 1 from Pisum with 72.81% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419886.1) |
| Pfam | Dormancy/auxin associated protein (PF05564.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer