Transcript | Ll_transcript_1597 |
---|---|
CDS coordinates | 231-587 (+) |
Peptide sequence | MVLLEKLWDDVVAGPHPERGLGKLRKLTTDIKDEGEGSKYERTVSMPTTPTTPVTPVTPRTPVSARKADNVWRSVFNPGSNSATKYMGAHQMFDKPLPNTPTVYDWLYSGESRSKHHR* |
ORF Type | complete |
Blastp | Dormancy-associated protein 1 from Pisum with 73.68% of identity |
---|---|
Blastx | Dormancy-associated protein 1 from Pisum with 72.81% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419886.1) |
Pfam | Dormancy/auxin associated protein (PF05564.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer