Protein coding transcript 185824

• Transcript: Ll_transcript_1615
• CDS coordinates: 148-492 (+)
• Peptide sequence: MASSSSDPAKSEIGAAAAETSEAAALPVAAMNDQALMYRGLKKAKKERGCTAKERISKMPPCAAGKRSSIYRGVTRHRWTGRYEAHLWDKSTWNQNQNKKGKQGSVLDFSFFVS*
• ORF Type: complete

Annotations of Ll_transcript_1615

• Blastp: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 71.84% of identity
• Blastx: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 94.37% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G41710)
• CantataDB: Link to cantataDB annotations (CNT0002638)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425551.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;