Protein coding transcript 185827

• Transcript: Ll_transcript_1621
• CDS coordinates: 1702-2727 (+)
• Peptide sequence: MISVSKDRYILSITRFKQINCSLIIKKCISCSLLVDSVIFVVSLTHMLQVTDYTRDLEEMQNVSREEYLASLRRKSSGFSRGLAKYRALSSRWEPSYSRIAGSDYFNSMHYGTGDDSAAESEYASGFCIERKIDLTGHIKWWGSNKGRQPDAGTRLSEEKKHGFAGDICSELKTLEQKVQPTEPYQMPELGRSHNEKKHRSSSVSALSILSKSAAYKSLQEKASKKRENSTDNDENENKNTVNKLDHGKAVDKSSNHDGDNDRLDIAMGTSGASCLQRNVYPSTPFLSAPLLTAYNTIDPSLVDPVLWTSLVPMLSASLSRPTEVTKTETSSSYTIFQPEE*
• ORF Type: complete

Annotations of Ll_transcript_1621

• Blastp: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 51.96% of identity
• Blastx: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 52.3% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G41710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425551.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;