Transcript | Ll_transcript_1623 |
---|---|
CDS coordinates | 408-1244 (+) |
Peptide sequence | MASSSSDPAKSEIGAAAAETSEAAALPVAAMNDQALMYRGLKKAKKERGCTAKERISKMPPCAAGKRSSIYRGVTRHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLGAYDDEEAAARAYDLAALKYWGPGTLINFPVTDYTRDLEEMQNVSREEYLASLRRKSSGFSRGLSKYRALSSRWEPSYGRIAGSDFFNSMHYGHDSVAESEYASDFCLERKIDLTSHIKWWGSNKSRQPDAGTRLSEEKKHGFAGDVCSELKMLEQKVQPTEPYQMPELGRSH |
ORF Type | 3prime_partial |
Blastp | AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 67.14% of identity |
---|---|
Blastx | AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 72.62% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT2G41710) |
CantataDB | Link to cantataDB annotations (CNT0002638) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444051.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer