Protein coding transcript 185829

• Transcript: Ll_transcript_1601
• CDS coordinates: 634-1056 (+)
• Peptide sequence: MMPVYLGAYDDEEAAARAYDLAALKYWGPGTLINFPVTDYTRDLEEMQNVSREEYLASLRRKSSGFSRGLSKYRALSRCESIKRLPNSFNNIDTYTQTNLYQLPLCFGTHSLLESYYNGCHGSVCFRFLAHILIVMLHPT*
• ORF Type: complete

Annotations of Ll_transcript_1601

• Blastp: Ethylene-responsive transcription factor WRI1 from Arabidopsis with 74.67% of identity
• Blastx: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 94.37% of identity
• Eggnog: Transcription factor(ENOG410Y9IH)
• Kegg: Link to kegg annotations (AT3G54320)
• CantataDB: Link to cantataDB annotations (CNT0002638)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444051.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;